TA334482 PNMA3 / MA3 antibody

Rabbit Polyclonal Anti-PNMA3 Antibody

See related secondary antibodies

Search for all "PNMA3 / MA3"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PNMA3 / MA3

Product Description for PNMA3 / MA3

Rabbit anti Human PNMA3 / MA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PNMA3 / MA3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Paraneoplastic antigen Ma3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PNMA3 antibody: synthetic peptide directed towards the middle region of human PNMA3. Synthetic peptide located within the following region: RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR.
Application WB
Background The specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functiol -1 ribosomal frameshift sigl (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PNMA3 / MA3 (1 products)

Catalog No. Species Pres. Purity   Source  

PNMA3 / MA3 (full length, N-term HIS tag)

PNMA3 / MA3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.
  • LinkedIn