H00079883-B01P PODNL1 antibody

See related secondary antibodies

Search for all "PODNL1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PODNL1

H00079883-B01P

Product Description for PODNL1

Mouse anti Human PODNL1.
Product is tested for Western blot / Immunoblot.

Properties for PODNL1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ23447, SLRR5B
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PEZ8
Immunogen:
PODNL1 (NP_079101.2, 1 a.a. ~ 512 a.a) full-length human protein.
AA Sequence:
MAESGLAMWPSLLLLLLLPGPPPVAGLEDAAFPHLGESLQPLLRACPLRCSCPRVDTVDCDGLDLRVFPDNITRAA QHLSLQNNQLQELPYNELSRLSGLRTLNLHNNLISSEGLPDEAFESLTQLQHLCVAHNKLSVAPQFLPRSLRVADL AANQVMEIFPLTFGEKPALRSVYLHNNQLSNAGLPPDAFRGSEAIATLSLSNNQLSYLPPSLPPSLERLHLQNNLI SKVPRGALSRQTQLRELYLQHNQLTDSGLDATTFSKLHSLEYLDLSHNQLTTVPAGLPRTLAILHLGRNRIRQVEA ARLHGARGLRYLLLQHNQLGSSGLPAGALRPLRGLHTLHLYGNGLDRVPPALPRRLRALVLPHNHVAALGARDLVA TPGLTELNLAYNRLASARVHHRAFRRLRALRSLDLAGNQLTRLPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLR ELSLAHNRLRVGDIGPGTWHELQALQVRHRLVSHTVPRAPPSPCLPCHVPNILVSW
GeneID:
79883
Add. information Mouse polyclonal antibody raised against a full-length human PODNL1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for PODNL1 (1 products)

Catalog No. Species Pres. Purity   Source  

PODNL1 overexpression lysate

PODNL1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn