discontinued

H00010623-B03P POLR3C / RPC3 antibody

See related secondary antibodies

Search for all "POLR3C / RPC3"

Quick Overview

Mouse anti Human, Rat POLR3C / RPC3

H00010623-B03P

More Views

  • H00010623-B03P
  • H00010623-B03P
  • H00010623-B03P

Product Description for POLR3C / RPC3

Mouse anti Human, Rat POLR3C / RPC3.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for POLR3C / RPC3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DNA-directed RNA polymerase III subunit RPC3, RNA polymerase III 62 kDa subunit, RNA polymerase III subunit C3, RPC62
Presentation Purified
Reactivity Hu, Rt
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUI4
Immunogen:
POLR3C (NP_006459.3, 1 a.a. ~ 534 a.a) full-length human protein.
AA Sequence:
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYE AQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMDYAEVSNTFVRLA DTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPI PDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNIS KQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQV EDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKE NKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK RQ
GeneID:
10623
Remarks:
Gene Accession: NM_006468.5
Add. information Mouse polyclonal antibody raised against a full-length human POLR3C protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Rat
Gene ID 10623

Accessory Products

Proteins and/or Positive Controls

Proteins for POLR3C / RPC3 (11 products)

Catalog No. Species Pres. Purity   Source  

POLR3C / RPC3

POLR3C / RPC3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

POLR3C / RPC3

POLR3C / RPC3 Human in vitro transl.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human in vitro transl.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human in vitro transl.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human Purified
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POLR3C / RPC3

POLR3C / RPC3 Human Purified 95 % E. coli
  GenWay Biotech Inc.

POLR3C / RPC3

POLR3C / RPC3 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for POLR3C / RPC3 (2 products)

Catalog No. Species Pres. Purity   Source  

POLR3C 293T Cell Transient Overexpression Lysate(Denatured)

POLR3C 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RPC62 Lysate

Western Blot: RPC62 Lysate [NBL1-14591] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POLR3C
  Novus Biologicals Inc.
  • LinkedIn