NBP1-53025 POLR3H antibody

See related secondary antibodies

Search for all "POLR3H"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human POLR3H

Product Description for POLR3H

Rabbit anti Human POLR3H.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR3H

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1665, MGC111097, MGC29654, RPC8
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B0QYH9
Immunogen:
Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
GeneID:
171568
Background POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 171568

Accessory Products

  • LinkedIn