discontinued

NBP1-53025 POLR3H antibody

See related secondary antibodies

Search for all "POLR3H"

50 µg / €440.00

Quick Overview

Rabbit anti Human POLR3H

Product Description for POLR3H

Rabbit anti Human POLR3H.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR3H

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1665, MGC111097, MGC29654, RPC8
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B0QYH9
Immunogen:
Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
GeneID:
171568
Background POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 171568

Accessory Products

  • LinkedIn