discontinued

H00010248-B01P POP7 antibody

See related secondary antibodies

Search for all "POP7"

Quick Overview

Mouse anti Human POP7

Product Description for POP7

Mouse anti Human POP7.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for POP7

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms RPP20, Ribonuclease P protein subunit p20, Ribonucleases P/MRP protein subunit POP7 homolog, hPOP7
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75817
Immunogen:
POP7 (AAH01430, 1 a.a. ~ 140 a.a) full-length human protein.
AA Sequence:
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGL AINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
GeneID:
10248
Remarks:
Gene Accession: BC001430
Add. information Mouse polyclonal antibody raised against a full-length human POP7 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10248

Accessory Products

Proteins and/or Positive Controls

Proteins for POP7 (7 products)

Catalog No. Species Pres. Purity   Source  

POP7

POP7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

POP7 (1-140, His-tag)

POP7 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €730.00
  OriGene Technologies GmbH

POP7 (1-140, His-tag)

POP7 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €300.00
  OriGene Technologies GmbH

POP7

POP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POP7

POP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POP7

POP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POP7

POP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for POP7 (2 products)

Catalog No. Species Pres. Purity   Source  

POP7 293T Cell Transient Overexpression Lysate(Denatured)

POP7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

POP7 overexpression lysate

POP7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn