discontinued

H00025913-A01 POT1 antibody

See related secondary antibodies

Search for all "POT1"

Quick Overview

Mouse anti Human POT1

Product Description for POT1

Mouse anti Human POT1.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for POT1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms POT1-like telomere end-binding protein, Protection of telomeres protein 1
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUX5
Immunogen:
POT1 (NP_056265, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
AA Sequence:
MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNG DIVRFHRLKIQVYKKETQG*
GeneID:
25913
Remarks:
Gene Accession: NM_015450
Add. information Mouse polyclonal antibody raised against a partial recombinant POT1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 25913

Accessory Products

Proteins and/or Positive Controls

Proteins for POT1 (3 products)

Catalog No. Species Pres. Purity   Source  

POT1 (transcript variant 1)

POT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

POT1

POT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POT1

POT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POT1 (1 products)

Catalog No. Species Pres. Purity   Source  

POT1 Lysate

Western Blot: POT1 Lysate [NBL1-14614] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for POT1.
  Novus Biologicals Inc.
  • LinkedIn