TA344380 POT1 antibody

Rabbit Polyclonal Anti-POT1 Antibody - middle region

See related secondary antibodies

Search for all "POT1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine POT1

Product Description for POT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine POT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POT1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms POT1-like telomere end-binding protein, Protection of telomeres protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-POT1 antibody: synthetic peptide directed towards the middle region of human POT1. Synthetic peptide located within the following region: MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN.
Application WB
Background This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintence. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombition, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptiol expression of this gene is associated with stomach carcinogenesis and its progression. Altertively spliced transcript variants have been described.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for POT1 (3 products)

Catalog No. Species Pres. Purity   Source  

POT1 (transcript variant 1)

POT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


POT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


POT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POT1 (1 products)

Catalog No. Species Pres. Purity   Source  

POT1 Lysate

Western Blot: POT1 Lysate [NBL1-14614] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for POT1.
  Novus Biologicals Inc.
  • LinkedIn