TA343478 POU4F2 antibody

Rabbit Polyclonal Anti-POU4F2 Antibody

See related secondary antibodies

Search for all "POU4F2"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat POU4F2

Product Description for POU4F2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat POU4F2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POU4F2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BRN3B, Brain-3B, Brain-specific homeobox/POU domain protein 3B, Brn-3B, POU domain class 4 transcription factor 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-POU4F2 antibody: synthetic peptide directed towards the N terminal of human POU4F2. Synthetic peptide located within the following region: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS.
Application WB
Background POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human reti exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human reti exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.[supplied by OMIM].
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for POU4F2 (1 products)

Catalog No. Species Pres. Purity   Source  


POU4F2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for POU4F2 (1 products)

Catalog No. Species Pres. Purity   Source  

POU4F2 overexpression lysate

POU4F2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn