discontinued

H00027068-B01P PPA2 antibody

See related secondary antibodies

Search for all "PPA2"

Quick Overview

Mouse anti Human PPA2

H00027068-B01P

More Views

  • H00027068-B01P

Product Description for PPA2

Mouse anti Human PPA2.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for PPA2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FLJ2045, HSPC124, Inorganic pyrophosphatase 2, Inorganic pyrophosphatase 2 mitochondrial, PPase 2, Pyrophosphatase SID6-306, Pyrophosphate phospho-hydrolase 2, SID6-306
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2U2
Immunogen:
PPA2 (NP_789845.1, 1 a.a. ~ 334 a.a) full-length human protein.
AA Sequence:
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEEN GIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIWNYGTLPQTWEDP HEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETDWKLIAINANDPEASKFHDIDDVKKFKP GYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLMKKCNGGAINCTNVQISDSPFRCTQ EEARSLVESVSSSPNKESNEEEQVWHFLGK
GeneID:
27068
Remarks:
Gene Accession: NM_176869.2
Add. information Mouse polyclonal antibody raised against a full-length human PPA2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 27068

Accessory Products

Proteins and/or Positive Controls

Proteins for PPA2 (8 products)

Catalog No. Species Pres. Purity   Source  

PPA2 (transcript variant 1)

PPA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PPA2 (full length, N-term HIS tag)

PPA2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

PPA2 (33-334, His-tag)

PPA2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

PPA2 (33-334, His-tag)

PPA2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

PPA2

PPA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPA2

PPA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPA2

PPA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPA2

PPA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PPA2 (5 products)

Catalog No. Species Pres. Purity   Source  

PPA2 293T Cell Transient Overexpression Lysate(Denatured)

PPA2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PPA2 Lysate

Western Blot: PPA2 Lysate [NBL1-14623] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPA2
  Novus Biologicals Inc.

PPA2 overexpression lysate

PPA2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

PPA2 overexpression lysate

PPA2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

PPA2 overexpression lysate

PPA2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn