TA334351 PPEF2 antibody

Rabbit Polyclonal Anti-PPEF2 Antibody

See related secondary antibodies

Search for all "PPEF2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PPEF2

Product Description for PPEF2

Rabbit anti Human PPEF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPEF2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms PPEF-2, Serine/threonine-protein phosphatase with EF-hands 2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14830
Immunogen:
The immunogen for anti-PPEF2 antibody is: synthetic peptide directed towards the C-terminal region of Human PPEF2. Synthetic peptide located within the following region: LVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKA.
GeneID:
5470
Application WB
Background This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown, the encoded protein, which is expressed specifically in photoreceptors and the pineal, has been suggested to play a role in the visual system. This gene shares high sequence similarity with the Drosophila retil degeneration C (rdgC) gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PPEF2 (1 products)

Catalog No. Species Pres. Purity   Source  

PPEF2 overexpression lysate

PPEF2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn