H00644591-B01P PPIAL4G antibody

See related secondary antibodies

Search for all "PPIAL4G"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PPIAL4G

H00644591-B01P

Product Description for PPIAL4G

Mouse anti Human PPIAL4G.
Product is tested for Western blot / Immunoblot.

Properties for PPIAL4G

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms BX284650.5, MGC163248, MGC163250
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A2BFH1
Immunogen:
PPIAL4G (ADR82833.1, 1 a.a. ~ 164 a.a) full-length human protein.
AA Sequence:
MVNSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTGDK SIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKT SKKITIADCGQF
GeneID:
653598
Add. information Mouse polyclonal antibody raised against a full-length human PPIAL4G protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for PPIAL4G (1 products)

Catalog No. Species Pres. Purity   Source  

PPIAL4G overexpression lysate

PPIAL4G overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn