discontinued

H00051645-M01 PPIL1 antibody

See related secondary antibodies

Search for all "PPIL1"

Quick Overview

Mouse anti Human PPIL1 2C2

H00051645-M01

More Views

  • H00051645-M01
  • H00051645-M01

Product Description for PPIL1

Mouse anti Human PPIL1 2C2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PPIL1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CYPL1, PPIase, Peptidyl-prolyl cis-trans isomerase-like 1, Rotamase PPIL1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2C2
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y3C6
Immunogen:
PPIL1 (NP_057143, 76 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQD RPVDDVKIIKAYPSG*
GeneID:
51645
Remarks:
Gene Accession: NM_016059
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant PPIL1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51645

Accessory Products

Proteins and/or Positive Controls

Proteins for PPIL1 (14 products)

Catalog No. Species Pres. Purity   Source  

PPIL1

PPIL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PPIL1

PPIL1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €399.00
  OriGene Technologies, Inc.

PPIL1 (1-166, His-tag)

PPIL1 Human Purified > 95 % by SDS PAGE E. coli
0.5 mg / €540.00
  Acris Antibodies GmbH

PPIL1 (1-166, His-tag)

PPIL1 Human Purified > 95 % by SDS PAGE E. coli
0.1 mg / €230.00
  Acris Antibodies GmbH

PPIL1 (recombinant) (aa 1-166)

PPIL1 Human Purified > 95 % E. coli
  Acris Antibodies GmbH

PPIL1

PPIL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPIL1

PPIL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPIL1

PPIL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPIL1

PPIL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPIL1

PPIL1 Human
  Abnova Taiwan Corp.

PPIL1

PPIL1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

PPIL1

PPIL1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

PPIL1

SDS-Page: PPIL1 Protein [NBC1-18375] - SlyD, 21 kDa (196 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

PPIL1

SDS-Page: PPIL1 Protein [NBC1-18379] - PPIL1, 19.3 kDa (174 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for PPIL1 (1 products)

Catalog No. Species Pres. Purity   Source  

PPIL1 Lysate

Western Blot: PPIL1 Lysate [NBL1-14651] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPIL1
  Novus Biologicals Inc.
  • LinkedIn