TA331182 PPP1R13L antibody

Rabbit Polyclonal Anti-PPP1R13L Antibody

See related secondary antibodies

Search for all "PPP1R13L"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PPP1R13L


More Views

  • TA331182
  • TA331182

Product Description for PPP1R13L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PPP1R13L.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for PPP1R13L

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IASPP, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13B-like protein, PPP1R13BL, RAI, RelA-associated inhibitor
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL.
Application WB
Background IASPP is one of the most evolutiorily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53.IASPP is one of the most evolutiorily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PPP1R13L (4 products)

Catalog No. Species Pres. Purity   Source  


PPP1R13L Human Purified
  Abnova Taiwan Corp.


PPP1R13L Human Purified
  Abnova Taiwan Corp.


PPP1R13L Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PPP1R13L Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PPP1R13L (1 products)

Catalog No. Species Pres. Purity   Source  

PPP1R13L 293T Cell Transient Overexpression Lysate(Denatured)

PPP1R13L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn