H00220004-B01P PPP1R32 antibody

See related secondary antibodies

Search for all "PPP1R32"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PPP1R32

H00220004-B01P

Product Description for PPP1R32

Mouse anti Human PPP1R32.
Product is tested for Western blot / Immunoblot.

Properties for PPP1R32

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C11orf66, IIIG9
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5V6
Immunogen:
PPP1R32 (AAH53995.1, 1 a.a. ~ 425 a.a) full-length human protein.
AA Sequence:
MMGKLPLGVVSPYVKMSSGGYTDPLKFYATSYCTAYGREDFKPRVGSHVGTGYKSNFQPVVSCQASLEALDNPARG EQAQDHFQSVASQSYRPLEVPDGKHPLPWSMRQTSSGYGREKPSAGPPTKEVRKVHFDTQEHGPQAITGLEPREVP LLHQQQGQDPLERENFRHGPRFMTSEYNSKYLRDPLDQPDFLQKKSIGAKEGSGFTKQSHQSPIVFQPPSQALPGD PALLPGQSVTKSDFLPKTHLHGDEFLPVLARGSKRETAFSRGNERILNPRVPPPCPEPSSVSHQQFQPLHRMQQTN VALLGRETVGKKEPTGFSLNNPMYVRSPCDPDRDQRYLTTYNQGYFENIPKGLDQEGWTRGGIQPQMPGGYALSQP VSCMEATPNPMESLRHLHPHVGRTLTSADPFYQNTPHSSRCVAHS
GeneID:
220004
Add. information Mouse polyclonal antibody raised against a full-length human PPP1R32 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn