NBP1-59173 PPP2R1B antibody

See related secondary antibodies

Search for all "PPP2R1B"

Quick Overview

Rabbit anti Human, Mouse, Rat PPP2R1B

Product Description for PPP2R1B

Rabbit anti Human, Mouse, Rat PPP2R1B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PPP2R1B

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC26454, PR65B
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PPP2R1B(protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform) The peptide sequence was selected from the N terminal of PPP2R1B. Peptide sequence EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYD
Background This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn