
NBP1-52915 PPP2R5C antibody

See related secondary antibodies

Search for all "PPP2R5C"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat PPP2R5C

Product Description for PPP2R5C

Rabbit anti Canine, Human, Mouse, Rat PPP2R5C.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PPP2R5C

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PPP2R5C(protein phosphatase 2, regulatory subunit B', gamma isoform) The peptide sequence was selected from the middle region of PPP2R5C. Peptide sequence RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIY
Background The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 5527

Accessory Products

  • LinkedIn