discontinued

NBP1-52915 PPP2R5C antibody

See related secondary antibodies

Search for all "PPP2R5C"

50 µg / €440.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat PPP2R5C

Product Description for PPP2R5C

Rabbit anti Canine, Human, Mouse, Rat PPP2R5C.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PPP2R5C

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96B13
Immunogen:
Synthetic peptides corresponding to PPP2R5C(protein phosphatase 2, regulatory subunit B', gamma isoform) The peptide sequence was selected from the middle region of PPP2R5C. Peptide sequence RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIY
GeneID:
5527
Background The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5527

Accessory Products

  • LinkedIn