discontinued

H00010084-A01 PQBP1 antibody

See related secondary antibodies

Search for all "PQBP1"

Quick Overview

Mouse anti Human PQBP1

Product Description for PQBP1

Mouse anti Human PQBP1.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PQBP1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms 38 kDa nuclear protein containing a WW domain, NPW38, PQBP-1, Polyglutamine tract-binding protein 1, Polyglutamine-binding protein 1
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O60828
Immunogen:
PQBP1 (NP_005701, 184 a.a. ~ 266 a.a) partial recombinant protein with GST tag.
AA Sequence:
LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEAS RTKQQD*
GeneID:
10084
Remarks:
Gene Accession: NM_005710
Add. information Mouse polyclonal antibody raised against a partial recombinant PQBP1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10084

Accessory Products

Proteins and/or Positive Controls

Proteins for PQBP1 (14 products)

Catalog No. Species Pres. Purity   Source  

PQBP1 (transcript variant 2)

PQBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PQBP1 (transcript variant 5)

PQBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PQBP1 (transcript variant 1)

PQBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

PQBP1 (transcript variant 3)

PQBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PQBP1 (transcript variant 4)

PQBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PQBP1 (transcript variant 10)

PQBP1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PQBP1 (1-265, His-tag)

PQBP1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

PQBP1 (1-265, His-tag)

PQBP1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

PQBP1

PQBP1 Human in vitro transl.
  Abnova Taiwan Corp.

PQBP1

PQBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PQBP1

PQBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PQBP1

PQBP1 Human Purified
  Abnova Taiwan Corp.

PQBP1

PQBP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PQBP1

PQBP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PQBP1 (11 products)

Catalog No. Species Pres. Purity   Source  

PQBP1 Lysate

Western Blot: PQBP1 Lysate [NBL1-14717] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PQBP1
  Novus Biologicals Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PQBP1 overexpression lysate

PQBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn