discontinued

H00078991-B01 Prenylcysteine oxidase-like antibody

See related secondary antibodies

Search for all "Prenylcysteine oxidase-like"

Quick Overview

Mouse anti Human Prenylcysteine oxidase-like

Product Description for Prenylcysteine oxidase-like

Mouse anti Human Prenylcysteine oxidase-like.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Prenylcysteine oxidase-like

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms MGC3265, PCYOX1L, PSEC0105
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBM8
Immunogen:
MGC3265 (AAH00014, 1 a.a. ~ 418 a.a) full-length human protein.
AA Sequence:
MPRRAKSVREGRAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEKGTVGGRLATISVNKQHYESGAASFHSLSLHMQD FVKLLGLRHRREVVGRSAIFGGEHFMLEETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMSYGQSAAMPAFAG AMSLAGAQGSLWSVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALYQVAYENEVGNSSDFYDIVVIATPL HLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANILTTDFPSFFCTLDNICPVNIS ASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSV EVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKVKTEL
GeneID:
78991
Remarks:
Gene Accession: BC000014
Add. information Mouse polyclonal antibody raised against a full-length human MGC3265 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 78991

Accessory Products

Proteins and/or Positive Controls

Proteins for Prenylcysteine oxidase-like (2 products)

Catalog No. Species Pres. Purity   Source  

Prenylcysteine oxidase-like

Prenylcysteine oxidase-like Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Prenylcysteine oxidase-like

Prenylcysteine oxidase-like Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Prenylcysteine oxidase-like (2 products)

Catalog No. Species Pres. Purity   Source  

PCYOX1L 293T Cell Transient Overexpression Lysate(Denatured)

PCYOX1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCYOX1L overexpression lysate

PCYOX1L overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn