TA331755 Prenylcysteine oxidase-like antibody

Rabbit Polyclonal Anti-PCYOX1L Antibody

See related secondary antibodies

Search for all "Prenylcysteine oxidase-like"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Prenylcysteine oxidase-like

Product Description for Prenylcysteine oxidase-like

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Prenylcysteine oxidase-like.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Prenylcysteine oxidase-like

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms MGC3265, PCYOX1L, PSEC0105
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBM8
Immunogen:
The immunogen for Anti-PCYOX1L Antibody is: synthetic peptide directed towards the C-terminal region of Human PCYOX1L. Synthetic peptide located within the following region: ANILTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQ.
GeneID:
78991
Application WB
Background PCYOX1L is a probable oxidoreductase.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Prenylcysteine oxidase-like (2 products)

Catalog No. Species Pres. Purity   Source  

Prenylcysteine oxidase-like

Prenylcysteine oxidase-like Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Prenylcysteine oxidase-like

Prenylcysteine oxidase-like Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Prenylcysteine oxidase-like (2 products)

Catalog No. Species Pres. Purity   Source  

PCYOX1L 293T Cell Transient Overexpression Lysate(Denatured)

PCYOX1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCYOX1L overexpression lysate

PCYOX1L overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn