NBP1-90645 PRHOXNB antibody

See related secondary antibodies

Search for all "PRHOXNB"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PRHOXNB

Product Description for PRHOXNB

Rabbit anti Human PRHOXNB.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for PRHOXNB

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NGE7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQEGILRCHPDLAGSELQRGTLTAESQREQ
GeneID:
646625
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 646625

Accessory Products

Proteins and/or Positive Controls

Proteins for PRHOXNB (1 products)

Catalog No. Species Pres. Purity   Source  

Parahox cluster neighbor (PRHOXNB)

Parahox cluster neighbor (PRHOXNB) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn