H00003276-B01P PRMT1 antibody

See related secondary antibodies

Search for all "PRMT1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PRMT1

H00003276-B01P

Product Description for PRMT1

Mouse anti Human PRMT1.
Product is tested for Western blot / Immunoblot.

Properties for PRMT1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms ANM1, HCP1, HRMT1L2, IR1B4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WUW5
Immunogen:
PRMT1 (ABZ92509.1, 1 a.a. ~ 343 a.a) full-length human protein.
AA Sequence:
MEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCM FAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYA RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVD IYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIF GTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
GeneID:
3276
Add. information Mouse polyclonal antibody raised against a full-length human PRMT1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for PRMT1 (1 products)

Catalog No. Species Pres. Purity   Source  

HRMT1L2

HRMT1L2 Human
0.1 mg / €330.00
  Abnova Taiwan Corp.
  • LinkedIn