NBP1-57088 Protein C antibody

See related secondary antibodies

Search for all "Protein C"

50 µg / €390.00

Quick Overview

Rabbit anti Human Protein C

Product Description for Protein C

Rabbit anti Human Protein C.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Protein C

Product Category Primary Antibodies
Quantity 50 µg
Synonyms COLEC1, HSMBPC, MBL, MBP, MBP1, MGC116832, MGC116833
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MBL2 (mannose-binding lectin (protein C) 2, soluble (opsonic defect)) The peptide sequence was selected from the middle region of MBL2. Peptide sequence KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Background This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn