discontinued

H00005494-M03 Protein phosphatase 1A / PPM1A antibody

See related secondary antibodies

Search for all "Protein phosphatase 1A / PPM1A"

Quick Overview

Mouse anti Human Protein phosphatase 1A / PPM1A 4E11

H00005494-M03

More Views

  • H00005494-M03

Product Description for Protein phosphatase 1A / PPM1A

Mouse anti Human Protein phosphatase 1A / PPM1A 4E11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for Protein phosphatase 1A / PPM1A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms PP2C-alpha, PPPM1A, Protein phosphatase 2C isoform alpha, Protein phosphatase IA
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 4E11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P35813
Immunogen:
PPM1A (AAH26691, 1 a.a. ~ 383 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLL DHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLC RNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSE EDDQFIILACDGIWDVMGNEELCDFVR
GeneID:
5494
Remarks:
Gene Accession: BC026691
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full-length recombinant PPM1A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,PLA-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5494

Accessory Products

Proteins and/or Positive Controls

Proteins for Protein phosphatase 1A / PPM1A (10 products)

Catalog No. Species Pres. Purity   Source  

Protein phosphatase 1A / PPM1A (transcript variant 1)

Protein phosphatase 1A / PPM1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Protein phosphatase 1A / PPM1A (transcript variant 3)

Protein phosphatase 1A / PPM1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Protein phosphatase 1A / PPM1A (transcript variant 1)

Protein phosphatase 1A / PPM1A Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Protein phosphatase 1A / PPM1A (1-382, His-tag)

Recombinant human PP2Calpha, His-tagged Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / €230.00
  OriGene Technologies GmbH

Protein phosphatase 1A / PPM1A (1-382, His-tag)

Recombinant human PP2Calpha, His-tagged Human Purified > 95 % by SDS-PAGE E. coli
0.5 mg / €540.00
  OriGene Technologies GmbH

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A (His-tagged)

SDS-Page: PPM1A  Protein [NBC1-18383] - PP2Ca, 46.6 kDa (418 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for Protein phosphatase 1A / PPM1A (3 products)

Catalog No. Species Pres. Purity   Source  

PPM1A 293T Cell Transient Overexpression Lysate(Denatured)

PPM1A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PPM1A Lysate

Western Blot: PPM1A Lysate [NBL1-14656] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPM1A
  Novus Biologicals Inc.

PPM1A overexpression lysate

PPM1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn