TA344616 Protein phosphatase 1A / PPM1A antibody

Rabbit Polyclonal Anti-PPM1A Antibody - middle region

See related secondary antibodies

Search for all "Protein phosphatase 1A / PPM1A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Protein phosphatase 1A / PPM1A

Product Description for Protein phosphatase 1A / PPM1A

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Protein phosphatase 1A / PPM1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Protein phosphatase 1A / PPM1A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms PP2C-alpha, PPPM1A, Protein phosphatase 2C isoform alpha, Protein phosphatase IA
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK.
Application WB
Background The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the acti
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Protein phosphatase 1A / PPM1A (10 products)

Catalog No. Species Pres. Purity   Source  

Protein phosphatase 1A / PPM1A (transcript variant 1)

Protein phosphatase 1A / PPM1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Protein phosphatase 1A / PPM1A (transcript variant 3)

Protein phosphatase 1A / PPM1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Protein phosphatase 1A / PPM1A (transcript variant 1)

Protein phosphatase 1A / PPM1A Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Protein phosphatase 1A / PPM1A (1-382, His-tag)

Recombinant human PP2Calpha, His-tagged Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / €250.00
  OriGene Technologies GmbH

Protein phosphatase 1A / PPM1A (1-382, His-tag)

Recombinant human PP2Calpha, His-tagged Human Purified > 95 % by SDS-PAGE E. coli
0.5 mg / €600.00
  OriGene Technologies GmbH

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A

Protein phosphatase 1A / PPM1A Human
  Abnova Taiwan Corp.

Protein phosphatase 1A / PPM1A (His-tagged)

SDS-Page: PPM1A  Protein [NBC1-18383] - PP2Ca, 46.6 kDa (418 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for Protein phosphatase 1A / PPM1A (3 products)

Catalog No. Species Pres. Purity   Source  

PPM1A 293T Cell Transient Overexpression Lysate(Denatured)

PPM1A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PPM1A Lysate

Western Blot: PPM1A Lysate [NBL1-14656] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPM1A
  Novus Biologicals Inc.

PPM1A overexpression lysate

PPM1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn