H00388199-B01P PRR25 antibody

See related secondary antibodies

Search for all "PRR25"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PRR25

H00388199-B01P

Product Description for PRR25

Mouse anti Human PRR25.
Product is tested for Western blot / Immunoblot.

Properties for PRR25

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms gs64
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96S07
Immunogen:
PRR25 (AAI56146.1, 1 a.a. ~ 402 a.a) full-length human protein.
AA Sequence:
MARTDQKPPCRGGCWGQPGHPNTGGAAAHPTYHPMGHRPRTCILLRGDQTTGGQAPSREISLGPWAAGTHFLAIST TPWGRKTPACISELPTSSGTAQPLANAVCEVQTVPGPGLRPQGTPAMRAPSHKGTPPTPNPWGPEQPQNRHKHPKK GVTGGPSPPPPAASRYGQTPGREPRVQAPGLGPCGRPASGRLLSLHLEKGDGKGTRQRIPLTDAAVGGDRTDIPSA IAAGPARTPDRHGLPIPGSTPTPMVGSGRLGAPVGRSGGGASARSSRPSCANVLLRADASLGTVLSVLWTGQLSRG WALLPPGDAGRHLETSVISAGVAAGIWLVEPGEAAQDPATRRTAPPRRTASPEPPAPGAPLPACPGRIPGAARFGP RSCPLGSPAVLAVTTGWSHRSV
GeneID:
388199
Add. information Mouse polyclonal antibody raised against a full-length human PRR25 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for PRR25 (1 products)

Catalog No. Species Pres. Purity   Source  

PRR25 overexpression lysate

PRR25 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn