TA337834 PRSS35 antibody

Rabbit Polyclonal Anti-PRSS35 Antibody

See related secondary antibodies

Search for all "PRSS35"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PRSS35

Product Description for PRSS35

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PRSS35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRSS35

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C6orf158, Inactive serine protease 35
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N3Z0
Immunogen:
The immunogen for anti-PRSS35 antibody: synthetic peptide directed towards the N terminal of human PRSS35. Synthetic peptide located within the following region: PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG.
GeneID:
167681
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRSS35 (2 products)

Catalog No. Species Pres. Purity   Source  

PRSS35

PRSS35 Human Purified
  Abnova Taiwan Corp.

PRSS35

PRSS35 Human Purified
  Abnova Taiwan Corp.

Positive controls for PRSS35 (3 products)

Catalog No. Species Pres. Purity   Source  

PRSS35 293T Cell Transient Overexpression Lysate(Denatured)

PRSS35 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PRSS35 Lysate

Western Blot: PRSS35 Lysate [NBL1-14848] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PRSS35
  Novus Biologicals Inc.

PRSS35 overexpression lysate

PRSS35 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn