NBP1-93439 PRSS42 antibody

See related secondary antibodies

Search for all "PRSS42"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PRSS42

Product Description for PRSS42

Rabbit anti Human PRSS42.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for PRSS42

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: CISSRFHYSVKMGDRSVYNENTSVVVSVQRAFVHPKFSTVTTIRNDLALL
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 339906

Accessory Products

Proteins and/or Positive Controls

Proteins for PRSS42 (1 products)

Catalog No. Species Pres. Purity   Source  

Testis serine protease 2 (TESSP2)

Testis serine protease 2 (TESSP2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
  OriGene Technologies, Inc.

Positive controls for PRSS42 (1 products)

Catalog No. Species Pres. Purity   Source  

PRSS42 overexpression lysate

PRSS42 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn