discontinued

H00221191-B01P PRSS54 / KLKBL4 antibody

See related secondary antibodies

Search for all "PRSS54 / KLKBL4"

Quick Overview

Mouse anti Human PRSS54 / KLKBL4

Product Description for PRSS54 / KLKBL4

Mouse anti Human PRSS54 / KLKBL4.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PRSS54 / KLKBL4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CT67, Cancer/testis antigen 67, Inactive serine protease 54, Plasma kallikrein-like protein 4
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PEW0
Immunogen:
Klkbl4 (AAH57843.1, 1 a.a. ~ 383 a.a) full-length human protein.
AA Sequence:
MRGVLLVLLGLLYSSTSCGVQKASVFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAIQNR KDIVVIVGISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTPPVLQNC WVSGWNPTSATGNHMTMSVLRKIFVKDLDMCPLYKLQKTECGSHTKEETKTACLGDPGSPMMCQLQQFDLWVLRGI LNFGGETCPGLFLYTKVEDYSKWITSKAERAGPPLSSLHHWEKLISFSHHGPNAAMTQKTYSDSELGHVGSYLQGQ RRTITHSRLGNSSRDSLDVREKDVKESGRSPEASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFC SSI
GeneID:
221191
Remarks:
Gene Accession: BC057843
Add. information Mouse polyclonal antibody raised against a full-length human Klkbl4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 221191

Accessory Products

Proteins and/or Positive Controls

Proteins for PRSS54 / KLKBL4 (2 products)

Catalog No. Species Pres. Purity   Source  

PRSS54 / KLKBL4

PRSS54 / KLKBL4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PRSS54 / KLKBL4

PRSS54 / KLKBL4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PRSS54 / KLKBL4 (2 products)

Catalog No. Species Pres. Purity   Source  

Klkbl4 293T Cell Transient Overexpression Lysate(Denatured)

Klkbl4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PRSS54 overexpression lysate

PRSS54 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn