TA334988 PRSS54 / KLKBL4 antibody

Rabbit Polyclonal Anti-PRSS54 Antibody

See related secondary antibodies

Search for all "PRSS54 / KLKBL4"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human PRSS54 / KLKBL4

Product Description for PRSS54 / KLKBL4

Rabbit anti Equine, Human PRSS54 / KLKBL4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRSS54 / KLKBL4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CT67, Cancer/testis antigen 67, Inactive serine protease 54, Plasma kallikrein-like protein 4
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PEW0
Immunogen:
The immunogen for anti-PRSS54 antibody: synthetic peptide directed towards the C terminal of human PRSS54. Synthetic peptide located within the following region: EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI.
GeneID:
221191
Application WB
Background PRSS54 is a secreted protein. PRSS54 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRSS54 / KLKBL4 (2 products)

Catalog No. Species Pres. Purity   Source  

PRSS54 / KLKBL4

PRSS54 / KLKBL4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PRSS54 / KLKBL4

PRSS54 / KLKBL4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PRSS54 / KLKBL4 (2 products)

Catalog No. Species Pres. Purity   Source  

Klkbl4 293T Cell Transient Overexpression Lysate(Denatured)

Klkbl4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PRSS54 overexpression lysate

PRSS54 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn