DM106P pS2 Estrogen Regulated Protein antibody

See related secondary antibodies

Search for all "pS2 Estrogen Regulated Protein"

0.1 mg / €250.00

Quick Overview

Mouse anti Human pS2 Estrogen Regulated Protein pS2.1

Product Description for pS2 Estrogen Regulated Protein

Mouse anti Human pS2 Estrogen Regulated Protein pS2.1.
Presentation: Purified
Product is tested for Frozen Sections, Paraffin Sections.

Properties for pS2 Estrogen Regulated Protein

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms TFF1
Presentation Purified
Reactivity Hu
Applications C, P
Clonality Monoclonal
Clone pS2.1
Host Mouse
Isotype IgG1
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Biomeda

Datasheet Extract

A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from c-terminus of human pS2 protein.
Isotype control AM03095PU-N, SM10P (for use in human samples)
Application Immunohistochemistry on frozen and paraffin embedded sections: 2-4 µg/ml 30Min RT. Recommended positive control: Normal Stomach or Breast Carcinoma. Other applications not tested. Optimal dilutions of this antibody are dependent on conditions and should be determined by the user.
Concentration 0.2 mg/ml
General Readings
  1. Masaiakowski P, et al. Nucleic Acids Res 10:7895-7903, 1982
  2. Jeltsh JM, et al. Nucleic Acids Res 15:1401-1414, 1987
  3. Mori K, et al. J Biochem 107:73-76, 1990
  4. Rio MC, et al. Scien
Storage Store the antibody at 4°C. Do not freeze! Shelf life: one year from despatch.

Aliquoting Instructions: Do not dilute the entire reconstituted solution at once. Withdraw aliquots as needed with a micropipette and keep concentrated stock at 4C. Dilute according to the particular application being used. In general, the 0.05M Borate pH 8.0 containing 0.15M Sodium Chloride, 0.05% Sodium Azide, is a good dilutent to use with most antibodies. Avoid diluting the entire contents of the vial at once since the diluted solution may have reduced stability.
pS2 is a cysteine-rich, 6.5 kD protein found in both estrogen-dependent (breast tumors) and estrogenindependent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Cellular Localization: cytoplasmic.

Mol. Wt. of Antigen: 6.5kD

Notes: Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.

Accessory Products

  • LinkedIn