
DM106P pS2 Estrogen Regulated Protein antibody

See related secondary antibodies

Search for all "pS2 Estrogen Regulated Protein"

Quick Overview

Mouse anti Human pS2 Estrogen Regulated Protein pS2.1


Product Description for pS2 Estrogen Regulated Protein

Mouse anti Human pS2 Estrogen Regulated Protein pS2.1.
Presentation: Purified
Product is tested for Frozen Sections, Paraffin Sections.

Properties for pS2 Estrogen Regulated Protein

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms TFF1
Presentation Purified
Reactivity Hu
Applications C, P
Clonality Monoclonal
Clone pS2.1
Host Mouse
Isotype IgG1
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Biomeda

Datasheet Extract

A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from c-terminus of human pS2 protein.
Isotype control AM03095PU-N
Application Immunohistochemistry on frozen and paraffin embedded sections: 2-4 µg/ml 30Min RT. Recommended positive control: Normal Stomach or Breast Carcinoma. Other applications not tested. Optimal dilutions of this antibody are dependent on conditions and should be determined by the user.
Concentration 0.2 mg/ml
General Readings
  1. Masaiakowski P, et al. Nucleic Acids Res 10:7895-7903, 1982
  2. Jeltsh JM, et al. Nucleic Acids Res 15:1401-1414, 1987
  3. Mori K, et al. J Biochem 107:73-76, 1990
  4. Rio MC, et al. Scien
Storage Store the antibody at 4°C. Do not freeze! Shelf life: one year from despatch.

Aliquoting Instructions: Do not dilute the entire reconstituted solution at once. Withdraw aliquots as needed with a micropipette and keep concentrated stock at 4C. Dilute according to the particular application being used. In general, the 0.05M Borate pH 8.0 containing 0.15M Sodium Chloride, 0.05% Sodium Azide, is a good dilutent to use with most antibodies. Avoid diluting the entire contents of the vial at once since the diluted solution may have reduced stability.
pS2 is a cysteine-rich, 6.5 kD protein found in both estrogen-dependent (breast tumors) and estrogenindependent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Cellular Localization: cytoplasmic.

Mol. Wt. of Antigen: 6.5kD

Notes: Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.

Accessory Products

  • LinkedIn