NBP1-56836 PSMA4 antibody

See related secondary antibodies

Search for all "PSMA4"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat PSMA4

Product Description for PSMA4

Rabbit anti Human, Mouse, Rat PSMA4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMA4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms HC9, HsT17706, MGC111191, MGC12467, MGC24813
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PSMA4(proteasome (prosome, macropain) subunit, alpha type, 4) The peptide sequence was selected from the N terminal of PSMA4. Peptide sequence PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN.
Background The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 5685

Accessory Products

  • LinkedIn