TA335804 PSMC2 / MSS1 antibody

Rabbit Polyclonal Anti-PSMC2 Antibody

See related secondary antibodies

Search for all "PSMC2 / MSS1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Rat PSMC2 / MSS1

Product Description for PSMC2 / MSS1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Rat PSMC2 / MSS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMC2 / MSS1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, Proteasome 19S S7, Proteasome 26S subunit ATPase 2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-PSMC2 Antibody: synthetic peptide directed towards the N terminal of human PSMC2. Synthetic peptide located within the following region: MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED.
Application WB
Background The 26S protease is involved in the ATP-dependent degradation of ubiquitited proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex. In case of HIV-1 infection, PSMC2 is a positive modulator of Tat-mediated transactivation.The 26S proteasome is a multicatalytic proteise complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This subunit may also compete with PSMC3 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMC2 / MSS1 (4 products)

Catalog No. Species Pres. Purity   Source  


PSMC2 / MSS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PSMC2 / MSS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PSMC2 / MSS1 Human Purified 95 % E. coli
  GenWay Biotech Inc.


PSMC2 / MSS1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for PSMC2 / MSS1 (1 products)

Catalog No. Species Pres. Purity   Source  

Proteasome 19S S7 Lysate

Western Blot: Proteasome 19S S7 Lysate [NBL1-14887] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PSMC2
  Novus Biologicals Inc.
  • LinkedIn