TA342178 PSME2 / REG-beta antibody

Rabbit polyclonal Anti-PSME2 Antibody

See related secondary antibodies

Search for all "PSME2 / REG-beta"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish PSME2 / REG-beta

Product Description for PSME2 / REG-beta

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish PSME2 / REG-beta.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSME2 / REG-beta

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, PA28b, PA28beta, Proteasome activator, Proteasome activator 28 subunit beta, Proteasome activator complex subunit 2
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH.
Application WB
Background The 26S proteasome is a multicatalytic proteise complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits.The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome,The immunoproteasome, isThe processing of class I MHC peptides.The immunoproteasome contains an alterte regulator, referred to asThe 11S regulator or PA28, that replacesThe 19S regulator. Three subunits (alpha, beta and gamma) ofThe 11S regulator have been identified.This gene encodesThe beta subunit ofThe 11S regulator, one ofThe two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13. [provided by RefSeq, Jul 2008].
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PSME2 / REG-beta (7 products)

Catalog No. Species Pres. Purity   Source  

PSME2 / REG-beta

PSME2 / REG-beta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PSME2 / REG-beta (1-239, His-tag)

PSME2 / REG-beta Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

PSME2 / REG-beta (1-239, His-tag)

PSME2 / REG-beta Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

PSME2 / REG-beta

PSME2 / REG-beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSME2 / REG-beta

PSME2 / REG-beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSME2 / REG-beta

PSME2 / REG-beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSME2 / REG-beta

PSME2 / REG-beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PSME2 / REG-beta (2 products)

Catalog No. Species Pres. Purity   Source  

PSME2 293T Cell Transient Overexpression Lysate(Denatured)

PSME2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PSME2 Lysate

Western Blot: PSME2 Lysate [NBL1-14908] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PSME2
  Novus Biologicals Inc.
  • LinkedIn