TA334357 PTCD3 antibody

Rabbit Polyclonal Anti-PTCD3 Antibody

See related secondary antibodies

Search for all "PTCD3"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat PTCD3

Product Description for PTCD3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat PTCD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PTCD3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Pentatricopeptide repeat-containing protein 3 mitochondrial, TRG-15, TRG15, Transformation-related gene 15 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PTCD3 antibody is: synthetic peptide directed towards the C-terminal region of Human PTCD3. Synthetic peptide located within the following region: LEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADI.
Application WB
Background Mitochondrial R-binding protein that has a role in mitochondrial translation.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PTCD3 (3 products)

Catalog No. Species Pres. Purity   Source  


PTCD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


PTCD3 Human Purified
  Abnova Taiwan Corp.


PTCD3 Human Purified
  Abnova Taiwan Corp.

Positive controls for PTCD3 (2 products)

Catalog No. Species Pres. Purity   Source  

PTCD3 Lysate

Western Blot: PTCD3 Lysate [NBL1-14923] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTCD3
  Novus Biologicals Inc.

PTCD3 overexpression lysate

PTCD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn