discontinued

H00005778-B02 PTPN7 / HEPTP antibody

See related secondary antibodies

Search for all "PTPN7 / HEPTP"

Quick Overview

Mouse anti Human PTPN7 / HEPTP

Product Description for PTPN7 / HEPTP

Mouse anti Human PTPN7 / HEPTP.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PTPN7 / HEPTP

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Hematopoietic protein-tyrosine phosphatase, Protein-tyrosine phosphatase LC-PTP, Tyrosine-protein phosphatase non-receptor type 7
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P35236
Immunogen:
PTPN7 (NP_002823.2, 1 a.a. ~ 360 a.a) full-length human protein.
AA Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLR TAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINA NYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKEC PEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIAT RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
GeneID:
5778
Remarks:
Gene Accession: NM_002832.2
Add. information Mouse polyclonal antibody raised against a full-length human PTPN7 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 5778

Accessory Products

Proteins and/or Positive Controls

Proteins for PTPN7 / HEPTP (7 products)

Catalog No. Species Pres. Purity   Source  

PTPN7 / HEPTP (transcript variant 1)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PTPN7 / HEPTP (transcript variant 2)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

PTPN7 / HEPTP

PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human
  Abnova Taiwan Corp.

Positive controls for PTPN7 / HEPTP (4 products)

Catalog No. Species Pres. Purity   Source  

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14977] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14978] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.
  • LinkedIn