TA343182 PTPN7 / HEPTP antibody

Rabbit Polyclonal Anti-PTPN7 Antibody

See related secondary antibodies

Search for all "PTPN7 / HEPTP"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PTPN7 / HEPTP

Product Description for PTPN7 / HEPTP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PTPN7 / HEPTP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PTPN7 / HEPTP

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Hematopoietic protein-tyrosine phosphatase, Protein-tyrosine phosphatase LC-PTP, Tyrosine-protein phosphatase non-receptor type 7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35236
Immunogen:
The immunogen for anti-Ptpn7 antibody is: synthetic peptide directed towards the middle region of Rat Ptpn7. Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ.
GeneID:
5778
Application WB
Background Tyrosine phosphatase found in T cells, B cells and mast cells.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 942% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PTPN7 / HEPTP (7 products)

Catalog No. Species Pres. Purity   Source  

PTPN7 / HEPTP (transcript variant 1)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PTPN7 / HEPTP (transcript variant 2)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

PTPN7 / HEPTP

PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human
  Abnova Taiwan Corp.

Positive controls for PTPN7 / HEPTP (4 products)

Catalog No. Species Pres. Purity   Source  

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14977] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14978] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.
  • LinkedIn