TA336083 PTRH2 / BIT1 antibody

Rabbit Polyclonal Anti-PTRH2 Antibody

See related secondary antibodies

Search for all "PTRH2 / BIT1"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit PTRH2 / BIT1

Product Description for PTRH2 / BIT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit PTRH2 / BIT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PTRH2 / BIT1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CGI-147, PTH2, Peptidyl-tRNA hydrolase 2 mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-PTRH2 Antibody: synthetic peptide directed towards the C terminal of human PTRH2. Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT.
Application WB
Background The tural substrate for this enzyme may be peptidyl-tRs which drop off the ribosome during protein synthesis.
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PTRH2 / BIT1 (6 products)

Catalog No. Species Pres. Purity   Source  

PTRH2 / BIT1 (64-179, His-tag)

PTRH2 / BIT1 Human Purified > 95 % E. coli
0.5 mg / €1,000.00
  Acris Antibodies GmbH

PTRH2 / BIT1 (64-179, His-tag)

PTRH2 / BIT1 Human Purified > 95 % E. coli
0.1 mg / €370.00
  Acris Antibodies GmbH


PTRH2 / BIT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PTRH2 / BIT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PTRH2 / BIT1 Human Purified
  Novus Biologicals Inc.


PTRH2 / BIT1 Human Purified
  Novus Biologicals Inc.

Positive controls for PTRH2 / BIT1 (4 products)

Catalog No. Species Pres. Purity   Source  

PTRH2 293T Cell Transient Overexpression Lysate(Denatured)

PTRH2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTRH2 / BIT1 Lysate(Denatured)

PTRH2 / BIT1 Lysate(Denatured)
  Abnova Taiwan Corp.

PTRH2 Lysate

Western Blot: PTRH2 Lysate [NBL1-14990] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTRH2
  Novus Biologicals Inc.

PTRH2 overexpression lysate

PTRH2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn