H00221749-B01P PXDC1 antibody

See related secondary antibodies

Search for all "PXDC1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PXDC1

H00221749-B01P

Product Description for PXDC1

Mouse anti Human PXDC1.
Product is tested for Western blot / Immunoblot.

Properties for PXDC1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C6orf145
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TGL8
Immunogen:
PXDC1 (NP_899229.1, 1 a.a. ~ 231 a.a) full-length human protein.
AA Sequence:
MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDAFPEDRS ELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERSPLDQVLKNDNVHKIQPSFQSPV KISEIMRSNGFCLANTETIVIDHSIPNGRDQHLGVDPTEHLFENGSEFPSELEDGDDPAAYVTNLSYYHLVPFETD IWD
GeneID:
221749
Add. information Mouse polyclonal antibody raised against a full-length human PXDC1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for PXDC1 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 6 open reading frame 145 (C6orf145)

Chromosome 6 open reading frame 145 (C6orf145) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for PXDC1 (1 products)

Catalog No. Species Pres. Purity   Source  

PXDC1 overexpression lysate

PXDC1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn