discontinued

H00005829-B02 PXN antibody

See related secondary antibodies

Search for all "PXN"

50 µl / €370.00

Quick Overview

Mouse anti Human PXN

Product Description for PXN

Mouse anti Human PXN.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PXN

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -, MaxPab, paxillin
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
PXN (XP_001132665.1, 1 a.a. ~ 262 a.a) full-length human protein.
AA Sequence:
MPDTFNSRSPSVEGSLWAVGTESQGRDWRHLPTITSELSGAPRCHTVPCAGSTALQEPGEPQGPPASPSCPEEALA ATWEQPWASEVFGPERMPPSGAARSFQEVTEPAVVAVDRQAIFPDTWTLTEEHGLQQERPRPEPGRLGSSSPASVT TEQLGAKMTERGSVARPTQGPETPRSPEGTTEAATQDGKEQPELPCAMAMGTPSTTERISTSGQAGTSSHGCWAWP LAGLSVGRSSLTACSLPLCACLLGQKMLRHCGRT
Remarks:
Gene Accession: XM_001132665
Add. information Mouse polyclonal antibody raised against a full-length human PXN protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn