discontinued

NBP1-57934 PYCR1 antibody

See related secondary antibodies

Search for all "PYCR1"

Quick Overview

Rabbit anti Human PYCR1

Product Description for PYCR1

Rabbit anti Human PYCR1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PYCR1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NFM2
Immunogen:
Synthetic peptides corresponding to PYCR1(pyrroline-5-carboxylate reductase 1) The peptide sequence was selected from the middle region of PYCR1. Peptide sequence RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE.
GeneID:
5831
Background This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5831

Accessory Products

  • LinkedIn