NBP1-54756 Pyruvate Dehydrogenase E2 antibody

See related secondary antibodies

Search for all "Pyruvate Dehydrogenase E2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti C. elegans, Human, Mouse, Rat Pyruvate Dehydrogenase E2

Product Description for Pyruvate Dehydrogenase E2

Rabbit anti C. elegans, Human, Mouse, Rat Pyruvate Dehydrogenase E2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Pyruvate Dehydrogenase E2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DLTA, PDC-E2, PDCE2
Presentation Aff - Purified
Reactivity Ce, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86YI5
Immunogen:
Synthetic peptides corresponding to DLAT(dihydrolipoamide S-acetyltransferase) The peptide sequence was selected from the C terminal of DLAT. Peptide sequence DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA.
GeneID:
1737
Background DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC; EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC; MIM 109720) show autoantibodies to DLAT.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2696 AK057299.1 1-2696 2697-3933 BC039084.1 2066-3302 3934-4322 DB551427.1 98-486
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 1737

Accessory Products

  • LinkedIn