TA342033 QPCTL antibody

Rabbit Polyclonal Anti-QPCTL Antibody

See related secondary antibodies

Search for all "QPCTL"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat QPCTL

Product Description for QPCTL

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat QPCTL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for QPCTL

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FLJ20084, Glutaminyl-peptide cyclotransferase-like protein, glutaminyl cyclase-like
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NXS2
Immunogen:
The immunogen for anti-QPCTL antibody: synthetic peptide directed towards the middle region of human QPCTL. Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML.
GeneID:
54814
Application WB
Background QPCTL is a single-pass membrane proteinPotential. It belongs toThe glutaminyl-peptide cyclotransferase family.The exact function of QPCTL remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for QPCTL (3 products)

Catalog No. Species Pres. Purity   Source  

QPCTL (transcript variant 1)

QPCTL Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

QPCTL

QPCTL Human Purified
  Abnova Taiwan Corp.

QPCTL

QPCTL Human Purified
  Abnova Taiwan Corp.

Positive controls for QPCTL (2 products)

Catalog No. Species Pres. Purity   Source  

QPCTL 293T Cell Transient Overexpression Lysate(Denatured)

QPCTL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

QPCTL overexpression lysate

QPCTL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn