discontinued

NBP1-94144 QRFP antibody

See related secondary antibodies

Search for all "QRFP"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human QRFP

Product Description for QRFP

Rabbit anti Human QRFP.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for QRFP

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P83859
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFR
GeneID:
347148
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 347148

Accessory Products

Proteins and/or Positive Controls

Positive controls for QRFP (1 products)

Catalog No. Species Pres. Purity   Source  

QRFP overexpression lysate

QRFP overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn