H00201475-B01P RAB12 antibody

See related secondary antibodies

Search for all "RAB12"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human RAB12

H00201475-B01P

Product Description for RAB12

Mouse anti Human RAB12.
Product is tested for Western blot / Immunoblot.

Properties for RAB12

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ45927, MGC104724
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IQ22
Immunogen:
RAB12 (NP_001020471.2, 1 a.a. ~ 244 a.a) full-length human protein.
AA Sequence:
MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVG VDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLL VGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEP EIPPELPPPRPHVRCC
GeneID:
201475
Add. information Mouse polyclonal antibody raised against a full-length human RAB12 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB12 (1 products)

Catalog No. Species Pres. Purity   Source  

RAB12, member RAS oncogene family (RAB12)

RAB12, member RAS oncogene family (RAB12) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for RAB12 (1 products)

Catalog No. Species Pres. Purity   Source  

RAB12 overexpression lysate

RAB12 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn