discontinued

H00005873-M01 RAB27A / RAB27 antibody

See related secondary antibodies

Search for all "RAB27A / RAB27"

Quick Overview

Mouse anti Human RAB27A / RAB27 4C1

H00005873-M01

More Views

  • H00005873-M01

Product Description for RAB27A / RAB27

Mouse anti Human RAB27A / RAB27 4C1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RAB27A / RAB27

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms GTP-binding protein Ram, RAB-27, Ras-related protein Rab-27A
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 4C1
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51159
Immunogen:
RAB27A (NP_004571, 122 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEG VVRSNGHASTDQLSEEKEKGACGC*
GeneID:
5873
Remarks:
Gene Accession: NM_004580
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant RAB27A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5873

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB27A / RAB27 (10 products)

Catalog No. Species Pres. Purity   Source  

RAB27A / RAB27 (transcript variant 2)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (transcript variant 3)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (transcript variant 1)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (transcript variant 4)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (1-221, His-tag)

RAB27A / RAB27 Human Purified > 90 % by SDS-PAGE E. coli
0.5 mg / €670.00
  Acris Antibodies GmbH

RAB27A / RAB27 (1-221, His-tag)

RAB27A / RAB27 Human Purified > 90 % by SDS-PAGE E. coli
0.1 mg / €250.00
  Acris Antibodies GmbH

RAB27A / RAB27

RAB27A / RAB27 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB27A / RAB27

RAB27A / RAB27 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB27A / RAB27

RAB27A / RAB27 Human
  Abnova Taiwan Corp.

RAB27A / RAB27

Western Blot: RAB27A Protein [NBP1-44380] - 15% SDS-PAGE (3ug) Human Purified
  Novus Biologicals Inc.
  • LinkedIn