TA342222 RAB27A / RAB27 antibody

Rabbit polyclonal Anti-RAB27A Antibody

See related secondary antibodies

Search for all "RAB27A / RAB27"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse RAB27A / RAB27

Product Description for RAB27A / RAB27

Rabbit anti Human, Mouse RAB27A / RAB27.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB27A / RAB27

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms GTP-binding protein Ram, RAB-27, Ras-related protein Rab-27A
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG.
Application WB
Background The protein encoded byThis gene belongs toThe small GTPase superfamily, Rab family.The protein is membrane-bound and may be involved in protein transport and small GTPase mediated sigl transduction. Mutations inThis gene are associated with Griscelli syndrome type 2. Altertive splicing occurs atThis locus and four transcript variants encodingThe same protein have been identified. [provided by RefSeq, Jul 2008].
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB27A / RAB27 (10 products)

Catalog No. Species Pres. Purity   Source  

RAB27A / RAB27 (transcript variant 2)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (transcript variant 3)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (transcript variant 1)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (transcript variant 4)

RAB27A / RAB27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB27A / RAB27 (1-221, His-tag)

RAB27A / RAB27 Human Purified > 90 % by SDS-PAGE E. coli
0.5 mg / €670.00
  Acris Antibodies GmbH

RAB27A / RAB27 (1-221, His-tag)

RAB27A / RAB27 Human Purified > 90 % by SDS-PAGE E. coli
0.1 mg / €250.00
  Acris Antibodies GmbH

RAB27A / RAB27

RAB27A / RAB27 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB27A / RAB27

RAB27A / RAB27 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB27A / RAB27

RAB27A / RAB27 Human
  Abnova Taiwan Corp.

RAB27A / RAB27

Western Blot: RAB27A Protein [NBP1-44380] - 15% SDS-PAGE (3ug) Human Purified
  Novus Biologicals Inc.
  • LinkedIn