TA345119 RAB3IL1 antibody

Rabbit Polyclonal Anti-RAB3IL1 Antibody - middle region

See related secondary antibodies

Search for all "RAB3IL1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat RAB3IL1

Product Description for RAB3IL1

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat RAB3IL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB3IL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms GRAB, Guanine nucleotide exchange factor for Rab-3A, Rab-3A-interacting-like protein 1, Rabin3-like 1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RAB3IL1 antibody: synthetic peptide directed towards the middle region of human RAB3IL1. Synthetic peptide located within the following region: ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH.
Application WB
Background This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kise InsP6K1. Altertive splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Nov 2012].
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB3IL1 (7 products)

Catalog No. Species Pres. Purity   Source  


RAB3IL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAB3IL1 (1-382, His-tag)

RAB3IL1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

RAB3IL1 (1-382, His-tag)

RAB3IL1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

RAB3IL1 (1-605, His-tag)

RAB3IL1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

RAB3IL1 (1-605, His-tag)

RAB3IL1 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH


RAB3IL1 Human Purified
  Abnova Taiwan Corp.


RAB3IL1 Human Purified
  Abnova Taiwan Corp.

Positive controls for RAB3IL1 (3 products)

Catalog No. Species Pres. Purity   Source  

RAB3IL1 293T Cell Transient Overexpression Lysate(Denatured)

RAB3IL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RAB3IL1 Lysate

Western Blot: RAB3IL1 Lysate [NBL1-15074] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB3IL1
  Novus Biologicals Inc.

RAB3IL1 overexpression lysate

RAB3IL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn