discontinued

H00004218-M02 RAB8A antibody

See related secondary antibodies

Search for all "RAB8A"

Quick Overview

Mouse anti Human RAB8A 3G1

H00004218-M02

More Views

  • H00004218-M02
  • H00004218-M02

Product Description for RAB8A

Mouse anti Human RAB8A 3G1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for RAB8A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms MEL, Oncogene c-mel, RAB8, Ras-related protein Rab-8A
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3G1
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P61006
Immunogen:
RAB8A (AAH02977, 108 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQ GSNQGVKITPDQQKRSSFFRCVLL
GeneID:
4218
Remarks:
Gene Accession: BC002977
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant RAB8A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4218

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB8A (5 products)

Catalog No. Species Pres. Purity   Source  

RAB8A

RAB8A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RAB8A

RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB8A

RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB8A

RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB8A

RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAB8A (1 products)

Catalog No. Species Pres. Purity   Source  

RAB8A Lysate

Western Blot: RAB8A Lysate [NBL1-15090] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB8A
  Novus Biologicals Inc.
  • LinkedIn