TA330007 RAB8A antibody

Rabbit Polyclonal Anti-RAB8A Antibody

See related secondary antibodies

Search for all "RAB8A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Monkey RAB8A


More Views

  • TA330007
  • TA330007

Product Description for RAB8A

Rabbit anti Human, Monkey RAB8A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB8A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms MEL, Oncogene c-mel, RAB8, Ras-related protein Rab-8A
Presentation Purified
Reactivity Hu, Mky
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP.
Application WB
Background RAB8A is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-termil CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignt melanoma has been demonstrable.The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-termil CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignt melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB8A (5 products)

Catalog No. Species Pres. Purity   Source  


RAB8A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


RAB8A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAB8A (1 products)

Catalog No. Species Pres. Purity   Source  

RAB8A Lysate

Western Blot: RAB8A Lysate [NBL1-15090] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB8A
  Novus Biologicals Inc.
  • LinkedIn