discontinued

H00010244-M01 RABEPK antibody

See related secondary antibodies

Search for all "RABEPK"

Quick Overview

Mouse anti Human RABEPK 4C9

Product Description for RABEPK

Mouse anti Human RABEPK 4C9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for RABEPK

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 40 kDa Rab9 effector protein, RAB9P40, Rab9 effector protein with kelch motifs
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 4C9
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6M1
Immunogen:
RABEPK (NP_005824, 273 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATL LCLVFGGMNTEGEIYDDCIVTVVD*
GeneID:
10244
Remarks:
Gene Accession: NM_005833
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant RABEPK.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10244

Accessory Products

Proteins and/or Positive Controls

Proteins for RABEPK (7 products)

Catalog No. Species Pres. Purity   Source  

RABEPK

RABEPK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 95 % E. coli
  GenWay Biotech Inc.

RABEPK

RABEPK Human Purified 95 % E. coli
  GenWay Biotech Inc.
  • LinkedIn